PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015880415.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 430aa    MW: 48154.6 Da    PI: 8.2704
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015880415.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.78.5e-103414291374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ L++cA++ +sg+l+ a+++L ++s+las +gd++qRlaa f+ ALa rl+++++++ykal+ ++ ++    e   a+++f +++P+l f++
  XP_015880415.1  41 LIQHLITCAKHTASGNLHHADSCLRQISHLASISGDSLQRLAARFASALALRLVKHWPGVYKALSYTQRPN--NPELDLARRVFRKAFPYLGFAY 133
                     6799************************************************************9999984..556666999************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg.ppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      +  +++l+++++e  +Hi+D++ +    W++L++++a  p+g  p+lRi  v+     +k  l ++g+rL k A++l+++f++n++ + +l++l
  XP_015880415.1 134 SIIARTLLQSMSHEGVIHIVDLGSGDTKLWVPLIRSFALLPSGiIPHLRISCVHG----DKAVLDKLGQRLVKEAQALDMTFQYNPINVANLKEL 224
                     **************************************99965389*********....************************************ PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrll......................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                     ++ +++ ++gEala  +vl+lh ll                      +e  ++    +++L +++s+ Pkvv +veqeadhn +++++r++ +l+
  XP_015880415.1 225 DIVMFEQRSGEALAFVSVLNLHALLaeddrvdahffrgkskdagivvKECKQM----EKFLTTIRSMCPKVVLLVEQEADHNLNRLVDRLVGSLN 315
                     ***************************************98776555444444....55************************************ PP

            GRAS 263 yysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                     yysa+fdsl++++++ s   eer  +E++ +grei+n++aceg er+erhe++++W  r++ aGFkpv+l  +  ++ k +++ +++dgy++ ++
  XP_015880415.1 316 YYSAVFDSLDVTFGSSSslmEERLALEEM-FGREIENIIACEGLERVERHERYGRWLVRFGGAGFKPVRLWFNGLEDCKKMVEAYGKDGYKIVSN 409
                     **************9999999********.***************************************************************** PP

            GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                     ++slv++W++rpL++vSaW+
  XP_015880415.1 410 KASLVICWHERPLYAVSAWT 429
                     *******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.42515409IPR005202Transcription factor GRAS
PfamPF035142.9E-10041429IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MNNCSSSSSP SLHPDVTLTL TIPSSSSKAS PLEPEQRGIY LIQHLITCAK HTASGNLHHA  60
DSCLRQISHL ASISGDSLQR LAARFASALA LRLVKHWPGV YKALSYTQRP NNPELDLARR  120
VFRKAFPYLG FAYSIIARTL LQSMSHEGVI HIVDLGSGDT KLWVPLIRSF ALLPSGIIPH  180
LRISCVHGDK AVLDKLGQRL VKEAQALDMT FQYNPINVAN LKELDIVMFE QRSGEALAFV  240
SVLNLHALLA EDDRVDAHFF RGKSKDAGIV VKECKQMEKF LTTIRSMCPK VVLLVEQEAD  300
HNLNRLVDRL VGSLNYYSAV FDSLDVTFGS SSSLMEERLA LEEMFGREIE NIIACEGLER  360
VERHERYGRW LVRFGGAGFK PVRLWFNGLE DCKKMVEAYG KDGYKIVSNK ASLVICWHER  420
PLYAVSAWTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-31414284374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015880415.10.0PREDICTED: scarecrow-like protein 3
TrEMBLA0A061EHA30.0A0A061EHA3_THECC; GRAS family transcription factor
STRINGPOPTR_0004s21850.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF158131011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-99scarecrow-like 3